DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:442 Identity:126/442 - (28%)
Similarity:207/442 - (46%) Gaps:70/442 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GDVMKQPLV-KDLYEHPDN-KFDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLG-NP 178
            ||:....|. ||:.|...| .||||:......|..| :..||....|:       ||.:.|| ..
  Rat    48 GDLCNHLLSRKDIMEFLKNANFDLVLFESVDYCSSL-IVEKLGKQFVL-------FLAFQLGFMD 104

  Fly   179 WEVSYVPGMSVSIKGG---KPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGD-DPTL-- 237
            :|:..||...|.:.|.   ..:.|..||.|         |:...:|  :|..|||... |.|:  
  Rat   105 FELQRVPLSYVPVYGSGLTDQMDFWGRVKN---------FLMFFDL--SRKQREILSQYDSTIQE 158

  Fly   238 -------PSYEDLHKNISLIF--------FASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQN 287
                   |...||.....|.|        ||         ||..|.::.:||: :.:..:.:||:
  Rat   159 HFAEGSRPVLSDLLLKAELWFVNCDFAFEFA---------RPLFPNIVYVGGL-LDKPVQSIPQD 213

  Fly   288 MEQFLSE-APNGAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIWKWDDLDNIPGE---SEN 348
            :|.|::: ..:|.:|::||:...:...| ..:::|.|..:.|.|.|||...| .:.|.:   :.|
  Rat   214 LENFITQFGDSGFVLVALGTVATKFQTK-EIIKEMNNAFAHLPQGVIWACKD-SHWPKDVTLAPN 276

  Fly   349 ILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQ 413
            :....|:||.|:||||:|.||:||.|...:.||..||.||:.:..|.|||.|...:.....|:..
  Rat   277 VKIMDWLPQTDLLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSI 341

  Fly   414 SILTLEEDSFLQGIREVLDNPKYATAVKSFSTLYRDRPLSPRETLIYWVEYVIRYHGAPHI---- 474
            .|.||:.::|.:.::||:::.:|.:|..:...:....||:|.:.|..|::::::..||.|:    
  Rat   342 QIQTLKAETFARTMKEVIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYA 406

  Fly   475 -QSPVVHMSYIAANNLDVYAVILGTIVALCFITKLLFGLVVGKLRKNSRKAK 525
             |.| .|..|:    |||:..:||..:...::...:.|.|:..| ..:||||
  Rat   407 FQQP-WHEQYL----LDVFLFLLGLTLGTVWLCVKVLGAVMRYL-SGARKAK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 122/438 (28%)
egt 13..483 CDD:223071 113/398 (28%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 114/405 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.