DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and ugt-64

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_503978.1 Gene:ugt-64 / 178774 WormBaseID:WBGene00015577 Length:501 Species:Caenorhabditis elegans


Alignment Length:235 Identity:66/235 - (28%)
Similarity:114/235 - (48%) Gaps:8/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GIQVKEQPERLPQNMEQFLSEAPN-GAILLSLGSNLKEDHLKSSTVQKMFNVLSKL-QQKVIWKW 336
            |.....|.:.|.::.|||:|:..: |.||::.|:.:..........:...|.|::| :.:|||..
 Worm   267 GTYCTAQKKVLDEDWEQFVSDPKSKGTILVAFGTIIDWRFAPEEKFEIFLNTLNRLTEYRVIWSM 331

  Fly   337 DDLDNIPGESENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA 401
            .. |...|..|::..|.||||..:|.|....||::|.|...:.||.....|.|.:|:|.:|..||
 Worm   332 KG-DRPKGLGEHVKISSWVPQQQILNHKKTVLFLSHGGLKSVKEAVCSATPSLFMPMFAEQMRNA 395

  Fly   402 DVMVMHGFGIKQSILTLEEDSFLQGIREVLDNPKYATAVKSFSTLYRDRPLSPRETLIYWVEYVI 466
            .:....||....:...|.|......||||:::..|....:.|.:.:.|:|:...:...:..|.:.
 Worm   396 WLAKSKGFARILNKFHLSEQYLENHIREVVEHKSYQIQAEQFLSTFTDQPMPALDEAAFKFERLF 460

  Fly   467 RYHG-APHIQSP-VVHMSYIAANNLDVYAV---ILGTIVA 501
            :|:| .|....| .:.:||:.|.|||::.:   :||.|::
 Worm   461 KYNGKMPKFFYPKTIDLSYLTALNLDIWVIVPLVLGYIIS 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 66/235 (28%)
egt 13..483 CDD:223071 57/212 (27%)
ugt-64NP_503978.1 Glycosyltransferase_GTB_type <271..468 CDD:299143 54/197 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.