DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT89B1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_177529.2 Gene:UGT89B1 / 843725 AraportID:AT1G73880 Length:473 Species:Arabidopsis thaliana


Alignment Length:300 Identity:62/300 - (20%)
Similarity:115/300 - (38%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 NDFQLGVAGKLKVP-------------VIVDWMIPSNTMIDEFVANPSEVSYVPNESTFATTPMS 154
            :||.||....|.:|             ::....|...|.|:|  .:.:|:.:.|.   ....|..
plant   126 SDFFLGWTKNLGIPRFDFSPSAAITCCILNTLWIEMPTKINE--DDDNEILHFPK---IPNCPKY 185

  Fly   155 FFKRAENLVK---HVILKYLTIRFNYKFN-----RIYNEIFTDKDMPTLSEMKKNISMVFVGSHL 211
            .|.:..:|.:   |....:..||.:::.|     .:.|. ||..:...|..:|:.:.    ...:
plant   186 RFDQISSLYRSYVHGDPAWEFIRDSFRDNVASWGLVVNS-FTAMEGVYLEHLKREMG----HDRV 245

  Fly   212 ISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQFME----NSSQGAIFLSFGSNIKSYMVKPEI 272
            .:.|||.||          ....:..|....::..|.    ......:::.|||.:  .:.|.:.
plant   246 WAVGPIIPL----------SGDNRGGPTSVSVDHVMSWLDAREDNHVVYVCFGSQV--VLTKEQT 298

  Fly   273 VGIMFKVLSGLKQ---NVIWKWE---DLENTPGN----------ASNIFYKDWLPQDDILAHPNT 321
            :.:    .|||::   :.||..:   :.::|.||          ...:..:.|.||..:|.|...
plant   299 LAL----ASGLEKSGVHFIWAVKEPVEKDSTRGNILDGFDDRVAGRGLVIRGWAPQVAVLRHRAV 359

  Fly   322 KLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVN 361
            ..|:||.|..|:.|:...||.|:..|:..|...:|:|:|:
plant   360 GAFLTHCGWNSVVEAVVAGVLMLTWPMRADQYTDASLVVD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 62/299 (21%)
egt 6..433 CDD:223071 62/299 (21%)
UGT89B1NP_177529.2 PLN02863 4..473 CDD:215465 62/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.