DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:519 Identity:110/519 - (21%)
Similarity:200/519 - (38%) Gaps:133/519 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MQPKVMH--KDIHLIVVPVTKEQERTLENQMASMAGSKN---NIITTMY----LLL----NGLDV 71
            |:..|:|  :..|::.||...:.......::|.:..:|.   ..:.|:|    ||.    |.||.
plant     1 MESHVVHNAQKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDG 65

  Fly    72 MVTSQADLLKD-------PRFQ---------------------RVFETKFDLMILGSFFND---- 104
            ..:.:.:.:.|       .|.|                     |....|.|:..:....:|    
plant    66 FPSFRFESIPDGLPETDGDRTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPVSCIVSDGVMS 130

  Fly   105 FQLGVAGKLKVPVIVDW---------MIPSNTMIDEFVANPSEVSYVPNESTFATTPMSFFKRAE 160
            |.|..|.:|.||.::.|         ::.....|::.::...:.||:..|  ...|.:.:....:
plant   131 FTLDAAEELGVPEVIFWTNSACGFMTILHFYLFIEKGLSPFKDESYMSKE--HLDTVIDWIPSMK 193

  Fly   161 NLVKHVILKYL--TIRFNYKFNRIYNEIFTDKD-----MPTLSEMKKNI--SMVFVGSHLISDGP 216
            ||....|..|:  |...|...|.:..|:...|.     :.|..|::.::  ||..:...:.|.||
plant   194 NLRLKDIPSYIRTTNPDNIMLNFLIREVERSKRASAIILNTFDELEHDVIQSMQSILPPVYSIGP 258

  Fly   217 IRPLVPAII----EVG--GIQV-KEQPDPLPQDIEQFMENSSQGAI-FLSFG------------- 260
            :..||...|    |:|  |:.: :|:.:.|     .:::..:..:: |::||             
plant   259 LHLLVKEEINEASEIGQMGLNLWREEMECL-----DWLDTKTPNSVLFVNFGCITVMSAKQLEEF 318

  Fly   261 -----SNIKSYM--VKPE-IVGIMFKVLSGLKQNVIWKWEDLENTPGNASNIFYKDWLPQDDILA 317
                 ::.|.::  ::|. :||         :..|:...|.|..|   ........|.||:.:|:
plant   319 AWGLAASRKEFLWVIRPNLVVG---------EAMVVLPQEFLAET---IDRRMLASWCPQEKVLS 371

  Fly   318 HPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQTITEDTFREAI 382
            ||....|:||.|..|..||...||||:..|.|.:.|.|.....:. :||.::   |.:|..||.:
plant   372 HPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDE-WGVGIE---IGKDVKREEV 432

  Fly   383 NEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFW---VDYVLRH-HGAP--NLQSPAVHMGFVE 440
            ..|         ||:.....:.:.|  |:....|   .:...|: ||:.  ||:: .:|..|:|
plant   433 ETV---------VRELMDGEKGKKL--REKAEEWRRLAEEATRYKHGSSVMNLET-LIHKVFLE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 110/519 (21%)
egt 6..433 CDD:223071 107/510 (21%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 105/503 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.