DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT76E1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_200766.2 Gene:UGT76E1 / 836077 AraportID:AT5G59580 Length:453 Species:Arabidopsis thaliana


Alignment Length:456 Identity:92/456 - (20%)
Similarity:159/456 - (34%) Gaps:135/456 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTAKALAEAGHNVTVVSMMQPKVM----HKDIHLIVVP--VTKEQERTLE--------NQMASM 51
            |...|||...|.::|||.....:|.    ..|.|.:.:|  :|:...:.|.        ||:...
plant    25 MQLGKALYSKGFSITVVLTQYNRVSSSKDFSDFHFLTIPGSLTESDLKNLGPFKFLFKLNQICEA 89

  Fly    52 AGSK----------NNIITTMYLLLNGLDVMVTSQADL----LKDPRFQRVFETKFDLMILGSFF 102
            :..:          |:|...:|     .:.|..|||.:    |....|.....|.|....:.|..
plant    90 SFKQCIGQLLQEQGNDIACVVY-----DEYMYFSQAAVKEFQLPSVLFSTTSATAFVCRSVLSRV 149

  Fly   103 N--DFQLGVAGKLKVPVIVDWMIPSNTMIDEFVANPSEVSYVPNESTFATTPMSFFKRAENLVKH 165
            |  .|.|    .:|.|.:.|...|.        .:|..         :...|.|.|...|:::| 
plant   150 NAESFLL----DMKDPKVSDKEFPG--------LHPLR---------YKDLPTSAFGPLESILK- 192

  Fly   166 VILKYLTIRFNYKFNRIYNEIFTDK-------------DMPTLSEMKKNISMVFVGSHLISDGPI 217
                            :|:|....:             :..:|:.::|.:.:           |:
plant   193 ----------------VYSETVNIRTASAVIINSTSCLESSSLAWLQKQLQV-----------PV 230

  Fly   218 RPLVPAIIEVGGIQVKEQPDPLPQD----IEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMFK 278
            .|:.|..|....      |..|.::    :|...:......|::|.||  .:.|...:    |.:
plant   231 YPIGPLHIAASA------PSSLLEEDRSCLEWLNKQKIGSVIYISLGS--LALMETKD----MLE 283

  Fly   279 VLSGLK---QNVIW----------KWEDLENTPGNASNI-----FYKDWLPQDDILAHPNTKLFV 325
            :..||:   |..:|          :|  .|:.|...|.:     :...|.||.::|.||....|.
plant   284 MAWGLRNSNQPFLWVIRPGSIPGSEW--TESLPEEFSRLVSERGYIVKWAPQIEVLRHPAVGGFW 346

  Fly   326 THAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNS-GYGVSLDLQTITEDTFREAINEVLEND 389
            :|.|..|..||...||||:..|..||..:||..:... ..||.|:.: :.:.|...|:..::.::
plant   347 SHCGWNSTLESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQLEGE-LDKGTVERAVERLIMDE 410

  Fly   390 K 390
            :
plant   411 E 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 92/456 (20%)
egt 6..433 CDD:223071 90/451 (20%)
UGT76E1NP_200766.2 Glycosyltransferase_GTB_type 1..450 CDD:299143 92/456 (20%)
YjiC 7..429 CDD:224732 92/456 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.