DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G38040

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:412 Identity:88/412 - (21%)
Similarity:138/412 - (33%) Gaps:120/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AKALAEAGHNVTVV----SMMQPKVMHKDIHLIVVPVTKEQERTLENQMASMAGSKNNIITTMYL 64
            ||||...|.::|||    :.:.|.....|...:.:|         ||...|   ...|:....:|
plant    29 AKALHSKGFSITVVQTKFNYLNPSNDLSDFQFVTIP---------ENLPVS---DLKNLGPGRFL 81

  Fly    65 LLNGLDVMVTSQADLLKDPRFQRVFETKFDLMILGSFFNDFQLGVAG-KLKVPVIVDWMIPSNTM 128
            :....:..| |..|||.......  |.:...:|...|....::.|.. ||:..::      |.|.
plant    82 IKLANECYV-SFKDLLGQLLVNE--EEEIACVIYDEFMYFVEVAVKEFKLRNVIL------STTS 137

  Fly   129 IDEFV-------------------ANPSEVSYVPN----------ESTFATTPMS--FFKRA--E 160
            ...||                   ....||..||.          .|.||:...|  .||..  :
plant   138 ATAFVCRFVMCELYAKDGLAQLKEGGEREVELVPELYPIRYKDLPSSVFASVESSVELFKNTCYK 202

  Fly   161 NLVKHVILKYLTIRFNYKFNRIYNEIFTDKDMPTLSEMKKNISMVFVGSHLISDGPIRPLVPAII 225
            .....||:.  |:|.              .:|.:|..:::.:.:     .:.|.||:..:|.|  
plant   203 GTASSVIIN--TVRC--------------LEMSSLEWLQQELEI-----PVYSIGPLHMVVSA-- 244

  Fly   226 EVGGIQVKEQPDPLPQD----IEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQN 286
                     .|..|.::    ||...:......|::|.||  .:.|...|::.:.:..:|. .|:
plant   245 ---------PPTSLLEENESCIEWLNKQKPSSVIYISLGS--FTLMETKEMLEMAYGFVSS-NQH 297

  Fly   287 VIWKWEDLENTPGN--ASNI---------------FYKDWLPQDDILAHPNTKLFVTHAGKGSIT 334
            .:|...     ||:  .|.|               :...|.||..:|||.....|.:|.|..|..
plant   298 FLWVIR-----PGSICGSEISEEELLKKMVITDRGYIVKWAPQKQVLAHSAVGAFWSHCGWNSTL 357

  Fly   335 ESQYHGVPMVALPIFGDHPLNA 356
            ||...|||::..|...|...||
plant   358 ESLGEGVPLICRPFTTDQKGNA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 88/412 (21%)
egt 6..433 CDD:223071 86/410 (21%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 88/412 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.