DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G38010

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:426 Identity:79/426 - (18%)
Similarity:134/426 - (31%) Gaps:138/426 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTAKALAEAGHNVTVV----SMMQPKVMHKDIHLIVVPVTKEQERTLENQMASMAGSKNNIITT 61
            |..|:||...|.::||.    :.::|.....|...|.:|             .|:..|....:..
plant    26 MQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFITIP-------------ESLPASDLKNLGP 77

  Fly    62 MYLLLNGLDVMVTSQADLLKDPRFQRVFETKFDLMILGSFFNDFQLGVAGKLKVPVIVDWMIPSN 126
            ::.||.           |.|:..|.  |:.     .||......||....::...:..::|..:.
plant    78 VWFLLK-----------LNKECEFS--FKE-----CLGQLLLQKQLIPEEEIACVIYDEFMYFAE 124

  Fly   127 TMIDEFVANPSEVSYVPNEST-----------FATTPMSFFKRAENLVKHVILKYLTIRFNYKFN 180
            ....||  |..:|.:....:|           :|...::..|......:.::.|...:|:     
plant   125 AAAKEF--NLPKVIFSTENATAFACRSAMCKLYAKDGLAPLKEGCGREEELVPKLHPLRY----- 182

  Fly   181 RIYNEIFTDKDMPTLSEMKKNISM-VFVGS----------------------------------- 209
                     ||:||.:......|: ||..|                                   
plant   183 ---------KDLPTSAFAPVEASVEVFKSSCDKGTASAMIINTVRCLEISSLEWLQQELKIPIYP 238

  Fly   210 ----HLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQFMENSSQGAIFLSFGSNIKSYMVKP 270
                |::|..|...|:               |.....|:...:......|::|.||  .:.:...
plant   239 IGPLHMVSSAPPTSLL---------------DENESCIDWLNKQKPSSVIYISLGS--FTLLETK 286

  Fly   271 EIVGIMFKVLSGL---KQNVIW------------KWEDLENTPGNASNIFYKDWLPQDDILAHPN 320
            |::    ::.|||   .|:.:|            ..|:|.:........:...|.||..:|||..
plant   287 EVL----EMASGLVSSNQHFLWVIRPGSILGSELTNEELLSMMEIPDRGYIVKWAPQKQVLAHSA 347

  Fly   321 TKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNA 356
            ...|.:|.|..|..||...||||:..|...|..:||
plant   348 VGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKVNA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 79/426 (19%)
egt 6..433 CDD:223071 77/421 (18%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 79/426 (19%)
YjiC 8..433 CDD:224732 79/426 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.