DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:151 Identity:35/151 - (23%)
Similarity:55/151 - (36%) Gaps:32/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PIRPLVPAIIEVGGIQVKEQP-----DPLPQDIEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGI 275
            ||.|:.|..:      |...|     |.....|:...:......|::|.||  .:.:...|::  
plant   207 PIYPIGPLYM------VSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGS--FTLLETKEVL-- 261

  Fly   276 MFKVLSGL-KQNVIWKW--------------EDLENTPGNASNIFYKDWLPQDDILAHPNTKLFV 325
              ::.||| ..|..:.|              |:|.:........:...|..|..:|||.....|.
plant   262 --EMASGLVSSNQYFLWAIRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFW 324

  Fly   326 THAGKGSITESQYHGVPMVAL 346
            :|.|..|..||...|:|:|.|
plant   325 SHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 35/151 (23%)
egt 6..433 CDD:223071 35/151 (23%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 33/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.