DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:262 Identity:50/262 - (19%)
Similarity:98/262 - (37%) Gaps:81/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IFTDKDMPTL-----------SEMKKNISM-------VFVGSHLISD------------------ 214
            ||.::.:|::           .|..|:.||       ||..|.::.|                  
plant   187 IFKEEHLPSIVRRSLQTPSPDLESIKDFSMNLLSYGSVFNSSEILEDDYLQYVKQRMGHDRVYVI 251

  Fly   215 GPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQFMENSSQGAI-FLSFGSNIKSYMVKPEIVGIMFK 278
            ||:..:        |..:|.....:...:..:::.|..|:: ::.|||  :..:.|.:...:.. 
plant   252 GPLCSI--------GSGLKSNSGSVDPSLLSWLDGSPNGSVLYVCFGS--QKALTKDQCDALAL- 305

  Fly   279 VLSGLKQNV---IW---------KWEDLENTPGNASNIFYKDWLPQDDILAHPNTKLFVTHAGKG 331
               ||::::   :|         .:||..:..|    :..:.|:.|..:|.|.....|::|.|..
plant   306 ---GLEKSMTRFVWVVKKDPIPDGFEDRVSGRG----LVVRGWVSQLAVLRHVAVGGFLSHCGWN 363

  Fly   332 SITESQYHGVPMVALPIFGDHPLNAALMVNSGYGVSL-------------DLQTITEDTFREAIN 383
            |:.|....|..::..|:..|..:||.|:|.. .||::             :|..:..:|..|...
plant   364 SVLEGITSGAVILGWPMEADQFVNARLLVEH-LGVAVRVCEGGETVPDSDELGRVIAETMGEGGR 427

  Fly   384 EV 385
            ||
plant   428 EV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 50/262 (19%)
egt 6..433 CDD:223071 50/262 (19%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 50/262 (19%)
YjiC 19..447 CDD:224732 50/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.