DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G17040

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:348 Identity:84/348 - (24%)
Similarity:148/348 - (42%) Gaps:59/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FQR---VFET----KFDLMILGSFFNDFQLGVAGKLKVPVIVDWMIPSNTMIDEFVANPSEVSYV 142
            |:|   |.||    |...|:..:|. .|...:|.::||..:..|...:.:::.....: ||...:
plant    91 FRRELAVAETEVGRKVTCMLTDAFI-WFAGDMAAEMKVSWVAFWTSGTRSLLISTQIS-SEKQSL 153

  Fly   143 PNESTFATTPMSFFKRAENLVKHVILKYLTIRFNYKFNR----------IYNEIFTDKDMPTLSE 197
            ..|:....:.|... |.::..:.|:...|...|:...::          :|...|.:.| |||::
plant   154 SKETLGCISGMEKI-RVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATTVYMNSFEELD-PTLTD 216

  Fly   198 MKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQD---IEQFMENSSQGAIFLSF 259
               |:.:.|  ...:|.||:..|         ....::..||...   :....:.|:...::::|
plant   217 ---NLRLKF--KRYLSIGPLALL---------FSTSQRETPLHDPHGCLAWIKKRSTASVVYIAF 267

  Fly   260 GSNIKSYMVKPEIVGIMFKVLSGLKQN---VIWKWED--LENTP-----GNASNIFYKDWLPQDD 314
            |    ..|..|.  |.:..|..||:.:   .:|..::  :.:.|     |.........|.||.:
plant   268 G----RVMTPPP--GELVVVAQGLESSKVPFVWSLQEKNMVHLPKGFLDGTREQGMVVPWAPQVE 326

  Fly   315 ILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGY--GVSLDLQTITEDT 377
            :|.|....:||:|.|..|:.||...||||:..||||||.|||. .|.:.:  |:::.....|:|.
plant   327 LLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHALNAR-SVEAVWEIGMTISSGVFTKDG 390

  Fly   378 FREAINEVLENDKYTQAVRKFSA 400
            |.|:::.||..|...:  .||:|
plant   391 FEESLDRVLVQDDGKK--MKFNA 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 84/348 (24%)
egt 6..433 CDD:223071 84/348 (24%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 84/348 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto2940
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.