DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:184 Identity:49/184 - (26%)
Similarity:83/184 - (45%) Gaps:26/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 IEVGGIQVKEQPDPL------PQDIEQFMENSSQGAI-FLSFGSNIKSYMVKP---EIVGIMFKV 279
            :.:|.:.:...|...      |.....::|..|..:: :::||.     :..|   |:|.|. :.
plant   242 LNIGPLALLSSPSQTSTLVHDPHGCLAWIEKRSTASVAYIAFGR-----VATPPPVELVAIA-QG 300

  Fly   280 LSGLKQNVIWKWEDLENT-------PGNASNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITESQ 337
            |...|...:|..::::.|       ...........|.||.::|.|....:||:|.|..|:.||.
plant   301 LESSKVPFVWSLQEMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESV 365

  Fly   338 YHGVPMVALPIFGDHPLNAALMVNSGY--GVSLDLQTITEDTFREAINEVLEND 389
            ..||||:..||||||.:||. .|.:.:  ||::.....|:|.|.|:::.||..|
plant   366 SAGVPMICRPIFGDHAINAR-SVEAVWEIGVTISSGVFTKDGFEESLDRVLVQD 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 49/184 (27%)
egt 6..433 CDD:223071 49/184 (27%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 49/184 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.