DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G05890

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_196208.1 Gene:AT5G05890 / 830474 AraportID:AT5G05890 Length:455 Species:Arabidopsis thaliana


Alignment Length:425 Identity:88/425 - (20%)
Similarity:153/425 - (36%) Gaps:150/425 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PKVMHKDIHLIVVPVTKEQERTLENQMASMAGSKNNIITTMYLLLNGLDVMVTSQADLLKDPRFQ 86
            || :.::::|   |:...::..|..:...:  .|.:|:..       |||    :.|:| ||...
plant   152 PK-LRREVYL---PLQDSEQEDLVQEFPPL--RKKDIVRI-------LDV----ETDIL-DPFLD 198

  Fly    87 RVFE-TKFD----LMILGSFFNDFQLGVAGKLKVPVIVDWMIPSNTMIDEFVANPSEVSYVPNES 146
            :|.: ||..    .|......:|.........|:|:              |...||. |:.|..|
plant   199 KVLQMTKASSGLIFMSCEELDHDSVSQAREDFKIPI--------------FGIGPSH-SHFPATS 248

  Fly   147 TFATTP----MSFFKRAENLVKHVILKYLTIRFNYKFNRIYNEIFT--DKDMPTLSEMKKNISMV 205
            :..:||    :.:..:.|:  |.||  |::          |..|.|  :.|:..::...:|    
plant   249 SSLSTPDETCIPWLDKQED--KSVI--YVS----------YGSIVTISESDLIEIAWGLRN---- 295

  Fly   206 FVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQFMENSSQGAIFLSFGSNIKSYMVKP 270
                   ||.|..    .::.||.::.:|..:.:|::|.:.:              |.|..:|| 
plant   296 -------SDQPFL----LVVRVGSVRGREWIETIPEEIMEKL--------------NEKGKIVK- 334

  Fly   271 EIVGIMFKVLSGLKQNVIWKWEDLENTPGNASNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITE 335
                                                  |.||.|:|.|.....|:||.|..|..|
plant   335 --------------------------------------WAPQQDVLKHRAIGGFLTHNGWSSTVE 361

  Fly   336 SQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQTITE-------------DTFREAINEVLE 387
            |....|||:.||...|..|||. .|:..:.|.::|:...|             :...|||.|.:|
plant   362 SVCEAVPMICLPFRWDQMLNAR-FVSDVWMVGINLEDRVERNEIEGAIRRLLVEPEGEAIRERIE 425

  Fly   388 N--DKYTQAVRKFSALYRDRPLTPRQSVLFWVDYV 420
            :  :|..::.::..:.|        ||:...:||:
plant   426 HLKEKVGRSFQQNGSAY--------QSLQNLIDYI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 88/425 (21%)
egt 6..433 CDD:223071 88/425 (21%)
AT5G05890NP_196208.1 Glycosyltransferase_GTB-type 2..455 CDD:385653 88/425 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.