DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:490 Identity:90/490 - (18%)
Similarity:171/490 - (34%) Gaps:141/490 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AKALAEAGHNVTVV----------------------SMMQPKVMHKDIHLIVVPVTKEQERTLEN 46
            ||.|...|.::||:                      .:.:.:...:|:.|::..:.:..|..:..
plant    27 AKILHSRGFSITVIHTCFNAPKASSHPLFTFIQIQDGLSETETRTRDVKLLITLLNQNCESPVRE 91

  Fly    47 QMASMAGSKNNIITTMYLLLNGLDVMVTSQADLLKDPRFQRVFETKFDLMILGSFFNDFQLGVAG 111
            .:..:..|.......:..|:|....:.|..  |.|.....|:....:.:....|.|      |..
plant    92 CLRKLLQSAKEEKQRISCLINDSGWIFTQH--LAKSLNLMRLAFNTYKISFFRSHF------VLP 148

  Fly   112 KLKVPVIVDWMIPSNTMIDEFVANPSEVSYVPNESTFATTPMSFFK--RAENLVKHVILKYLTIR 174
            :|:                       ...::|.:.:....|:..|.  |.::|::  ||:..:::
plant   149 QLR-----------------------REMFLPLQDSEQDDPVEKFPPLRKKDLLR--ILEADSVQ 188

  Fly   175 FNYKFNRIYNEIFTDK---------------DMPTLSEMKKNISMVFVGSHLISDGPIRPLVPAI 224
                 ...|:::..:|               |..:||:.:::..:     .:.:.||.....|| 
plant   189 -----GDSYSDMILEKTKASSGLIFMSCEELDQDSLSQSREDFKV-----PIFAIGPSHSHFPA- 242

  Fly   225 IEVGGIQVKEQPDPLPQDIEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIW 289
                  .......|....|........:..|::|.||.:.  :.:.|::.|.:. ||...|..:|
plant   243 ------SSSSLFTPDETCIPWLDRQEDKSVIYVSIGSLVT--INETELMEIAWG-LSNSDQPFLW 298

  Fly   290 ----------KWEDLENTPGNASNIFYK---------DWLPQDDILAHPNTKLFVTHAGKGSITE 335
                      :|  :|..|    ..|.|         .|.||.::|.|.....|:||.|..|..|
plant   299 VVRVGSVNGTEW--IEAIP----EYFIKRLNEKGKIVKWAPQQEVLKHRAIGGFLTHNGWNSTVE 357

  Fly   336 SQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQTITE-------------DTFREAINEVLE 387
            |...||||:.||...|..|||. .|:..:.|.:.|:...|             :|..|||.|.::
plant   358 SVCEGVPMICLPFRWDQLLNAR-FVSDVWMVGIHLEGRIERDEIERAIRRLLLETEGEAIRERIQ 421

  Fly   388 --NDKYTQAVRKFSALYRDRPLTPRQSVLFWVDYV 420
              .:|..::|::..:.|        ||:...::|:
plant   422 LLKEKVGRSVKQNGSAY--------QSLQNLINYI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 90/490 (18%)
egt 6..433 CDD:223071 88/488 (18%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 90/490 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.