DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT73B2

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_567954.1 Gene:UGT73B2 / 829560 AraportID:AT4G34135 Length:483 Species:Arabidopsis thaliana


Alignment Length:172 Identity:42/172 - (24%)
Similarity:71/172 - (41%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 IFLSFGSNIKSYMVKPEIVGIMFKVLSGLK---QNVIW----------KW--EDLENTPGNASNI 304
            |::||||  .::....:    :|::.:||:   .:.||          :|  |..|... ....:
plant   292 IYVSFGS--VAFFKNEQ----LFEIAAGLEASGTSFIWVVRKTKDDREEWLPEGFEERV-KGKGM 349

  Fly   305 FYKDWLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPI-----FGDHPLNAALMVNSGY 364
            ..:.|.||..||.|..|..||||.|..|:.|....|:|||..|:     :.:..:...|......
plant   350 IIRGWAPQVLILDHQATGGFVTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLRTGVSV 414

  Fly   365 GVSLDLQT-----ITEDTFREAINEVLENDKYTQAVRKFSAL 401
            |.|..::.     |:.:...:|:.|||..:...:..|:...|
plant   415 GASKHMKVMMGDFISREKVDKAVREVLAGEAAEERRRRAKKL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 42/172 (24%)
egt 6..433 CDD:223071 42/172 (24%)
UGT73B2NP_567954.1 PLN03007 5..483 CDD:178584 42/172 (24%)
MGT 15..441 CDD:273616 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.