DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and IAGLU

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_567471.1 Gene:IAGLU / 827229 AraportID:AT4G15550 Length:474 Species:Arabidopsis thaliana


Alignment Length:348 Identity:68/348 - (19%)
Similarity:125/348 - (35%) Gaps:86/348 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VAGKLKVPVIVDWMIPSNTM-------------IDEFVANPSEVSYVPNESTFATTPMSFFKRAE 160
            :|.:..:|..:.|:.|....             |.|....||....:|:........:..|    
plant   138 LAREFHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMANTPSSSIKLPSLPLLTVRDIPSF---- 198

  Fly   161 NLVKHVILKYLTIRFNYKFNRIYNEI--------FTDKDMPTLSEMKKNISMVFVGSHLISDGPI 217
             :|...:..:|...|..:.:.:..||        |.:.:...:|.:..|..:|          |:
plant   199 -IVSSNVYAFLLPAFREQIDSLKEEINPKILINTFQELEPEAMSSVPDNFKIV----------PV 252

  Fly   218 RPLVPAIIEVGGIQVKEQPDPLPQDIEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSG 282
            .||         :.::.......:.||.....:....:::|||:  .:.:.|.::|.:. |.|..
plant   253 GPL---------LTLRTDFSSRGEYIEWLDTKADSSVLYVSFGT--LAVLSKKQLVELC-KALIQ 305

  Fly   283 LKQNVIW--------KWEDLENTPGNASNIFYKD---------WLPQDDILAHPNTKLFVTHAGK 330
            .::..:|        ..||.:....:..:.|.::         |..|..:|.|.:...||||.|.
plant   306 SRRPFLWVITDKSYRNKEDEQEKEEDCISSFREELDEIGMVVSWCDQFRVLNHRSIGCFVTHCGW 370

  Fly   331 GSITESQYHGVPMVALPIFGDHPLNAALMVN---SGYGV-----SLDLQTITEDTFREAINEVLE 387
            .|..||...|||:||.|.:.|..:||.|:.:   :|..|     ...:..:..:..|..|.||:|
plant   371 NSTLESLVSGVPVVAFPQWNDQMMNAKLLEDCWKTGVRVMEKKEEEGVVVVDSEEIRRCIEEVME 435

  Fly   388 N-------------DKYTQAVRK 397
            :             |...:|||:
plant   436 DKAEEFRGNATRWKDLAAEAVRE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 68/348 (20%)
egt 6..433 CDD:223071 68/348 (20%)
IAGLUNP_567471.1 Glycosyltransferase_GTB_type 12..472 CDD:299143 68/348 (20%)
YjiC 13..455 CDD:224732 65/343 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.