DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:454 Identity:102/454 - (22%)
Similarity:155/454 - (34%) Gaps:156/454 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MAGSKNNIITTMYLLLNGLD----------VMVTSQADLL---------------KDPRFQRVFE 90
            :.||:|.:..|:.::.:..|          :...||.|.|               .||...:|:.
plant    58 LIGSENRLSITIIIIPSRFDAGDASACIASLTTLSQDDRLHYESISVAKQPPTSDPDPVPAQVYI 122

  Fly    91 TKFDLMILGSFFNDFQLGVAGKLKVPV------IVDWMIPSNTMIDEFVAN----PSEVSYVPNE 145
            .|....:..:        ||.::..|.      :||....|  |||  |||    |..:.|..| 
plant   123 EKQKTKVRDA--------VAARIVDPTRKLAGFVVDMFCSS--MID--VANEFGVPCYMVYTSN- 174

  Fly   146 STFATTPMSF----------FKRAENLVKHVILKYLTIRFNYKFNRIYNEIFTDKD-MP------ 193
            :||..|.:..          ....||.|..:....||..:..|   ....|.|.|: :|      
plant   175 ATFLGTMLHVQQMYDQKKYDVSELENSVTELEFPSLTRPYPVK---CLPHILTSKEWLPLSLAQA 236

  Fly   194 ------------TLSEMKKNISMVF--VGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIE 244
                        |::|::.:...:|  .|..|....|:.|::.  :|.|....::|.:.|    .
plant   237 RCFRKMKGILVNTVAELEPHALKMFNINGDDLPQVYPVGPVLH--LENGNDDDEKQSEIL----R 295

  Fly   245 QFMENSSQGAIFLSFGS--------------------------------NIKS-----YMVKPEI 272
            ...|..|:..:||.|||                                |||:     |....|:
plant   296 WLDEQPSKSVVFLCFGSLGGFTEEQTRETAVALDRSGQRFLWCLRHASPNIKTDRPRDYTNLEEV 360

  Fly   273 VGIMFKVLSGLKQNVIWKWEDLENTPGNASNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITESQ 337
            :...|                ||.|......|   .|.||..:|..|....||||.|..||.||.
plant   361 LPEGF----------------LERTLDRGKVI---GWAPQVAVLEKPAIGGFVTHCGWNSILESL 406

  Fly   338 YHGVPMVALPIFGDHPLNAALMVNS-GYGVSL-----------DLQTITEDTFREAINEVLEND 389
            :.|||||..|::.:..:||..||.. |..|.:           :::|:|.:....||..|:|.|
plant   407 WFGVPMVTWPLYAEQKVNAFEMVEELGLAVEIRKYLKGDLFAGEMETVTAEDIERAIRRVMEQD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 102/454 (22%)
egt 6..433 CDD:223071 102/454 (22%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2351
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.