DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT3G55700

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_191129.1 Gene:AT3G55700 / 824736 AraportID:AT3G55700 Length:460 Species:Arabidopsis thaliana


Alignment Length:269 Identity:65/269 - (24%)
Similarity:104/269 - (38%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 IYNEIFTDKDMPTLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLP-----Q 241
            |:| .|.|.:..:|......:.:.|.        ||.|.           .|...||.|     :
plant   211 IWN-TFEDLERLSLMNCSSKLQVPFF--------PIGPF-----------HKYSEDPTPKTENKE 255

  Fly   242 DIEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQN---VIW----------KWED 293
            |.:...:...|..::.||||  .:.:.:.|.:.|.:    ||:.:   .:|          :|  
plant   256 DTDWLDKQDPQSVVYASFGS--LAAIEEKEFLEIAW----GLRNSERPFLWVVRPGSVRGTEW-- 312

  Fly   294 LENTP-GNASNIFYK----DWLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHP 353
            ||:.| |...||..|    .|..|.::||||....|.||.|..|..||...||||:....|.|..
plant   313 LESLPLGFMENIGDKGKIVKWANQLEVLAHPAIGAFWTHCGWNSTLESICEGVPMICTSCFTDQH 377

  Fly   354 LNAALMVNS-GYGVSLDLQTITEDTFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWV 417
            :||..:|:. ..|:.|:...:.:....:.:..|:        :.|...| |:|.|..::.    .
plant   378 VNARYIVDVWRVGMLLERSKMEKKEIEKVLRSVM--------MEKGDGL-RERSLKLKER----A 429

  Fly   418 DYVLRHHGA 426
            |:.|...|:
plant   430 DFCLSKDGS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 65/269 (24%)
egt 6..433 CDD:223071 65/269 (24%)
AT3G55700NP_191129.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 65/269 (24%)
YjiC 8..427 CDD:224732 62/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.