DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT73D1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_190883.2 Gene:UGT73D1 / 824481 AraportID:AT3G53150 Length:516 Species:Arabidopsis thaliana


Alignment Length:211 Identity:51/211 - (24%)
Similarity:85/211 - (40%) Gaps:53/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 GGIQVKEQPDPLPQDIEQFMEN-SSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQN---VI 288
            |.|.:.|      .:..||::: ..:..:::|.||..:  ::..:::.:..    ||:::   .|
plant   279 GNIAISE------TECLQFLDSMRPRSVLYVSLGSLCR--LIPNQLIELGL----GLEESGKPFI 331

  Fly   289 W-------------KWEDLENTPG--NASNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITESQY 338
            |             :|...||...  ....|..|.|.||..||:|.:|..|:||.|..|..|:..
plant   332 WVIKTEEKHMIELDEWLKRENFEERVRGRGIVIKGWSPQAMILSHGSTGGFLTHCGWNSTIEAIC 396

  Fly   339 HGVPMVALPIFGDHPLNAALMV---NSGYGVSLDLQTITEDTFREAI------------------ 382
            .||||:..|:|.:..||..|:|   |.|..|.:::.....|..|..:                  
plant   397 FGVPMITWPLFAEQFLNEKLIVEVLNIGVRVGVEIPVRWGDEERLGVLVKKPSVVKAIKLLMDQD 461

  Fly   383 -NEVLENDKYTQAVRK 397
             ..|.|||...:.||:
plant   462 CQRVDENDDDNEFVRR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 51/211 (24%)
egt 6..433 CDD:223071 51/211 (24%)
UGT73D1NP_190883.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.