DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT72E1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:468 Identity:86/468 - (18%)
Similarity:150/468 - (32%) Gaps:178/468 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KALAEAGHNVTVVSMMQPKVMHKDIHLIV-------VPVTKEQERTLENQMASMAGSKNNIITTM 62
            |.|......:..:.....::.||...|||       :|:                |.:.|::|.:
plant    87 KLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGLDAIPL----------------GGEFNMLTYI 135

  Fly    63 YLLLNG-----------LDVMVTSQADLLKDP---------RFQRVFETKFDLMILGSFFNDFQL 107
            ::..|.           ||..:..:..:.|.|         ||:...||..|             
plant   136 FIASNARFLAVALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFEDTLETFLD------------- 187

  Fly   108 GVAGKLKVPVIVDWMIPSNTMIDEFVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLT 172
                            |::.:..||         ||..|.|.|.                     
plant   188 ----------------PNSQLYREF---------VPFGSVFPTC--------------------- 206

  Fly   173 IRFNYKFNRIYNEIFTDKDMPTLSEMK--KNISMVFVGSHLISDGPI-RPLVPA-----IIEVGG 229
                   :.|....:.|.:..||..::  |.:..: .|..:...||: ||:.|:     :::   
plant   207 -------DGIIVNTWDDMEPKTLKSLQDPKLLGRI-AGVPVYPIGPLSRPVDPSKTNHPVLD--- 260

  Fly   230 IQVKEQPDPLPQDIEQFMENSSQGAIFLSFGS----NIKS----------------YMVKPEIVG 274
             .:.:|||              :..:::||||    :.|.                ::|:|.:.|
plant   261 -WLNKQPD--------------ESVLYISFGSGGSLSAKQLTELAWGLEMSQQRFVWVVRPPVDG 310

  Fly   275 IMFKVLSGLKQNVIWKWEDLENTPG----------NASNIFYKDWLPQDDILAHPNTKLFVTHAG 329
            .............|     .:.||.          :........|.||.:||||.....|:||.|
plant   311 SACSAYLSANSGKI-----RDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQAVGGFLTHCG 370

  Fly   330 KGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQ------TITEDTFREAINEVLEN 388
            ..||.||...||||:|.|:|.:..:||.|: |...||::..:      .||.......:.:::..
plant   371 WNSILESVVGGVPMIAWPLFAEQMMNATLL-NEELGVAVRSKKLPSEGVITRAEIEALVRKIMVE 434

  Fly   389 DKYTQAVRKFSAL 401
            ::..:..:|...|
plant   435 EEGAEMRKKIKKL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 86/468 (18%)
egt 6..433 CDD:223071 85/467 (18%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 86/468 (18%)
YjiC 5..479 CDD:224732 86/468 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.