DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT3G46690

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:275 Identity:65/275 - (23%)
Similarity:110/275 - (40%) Gaps:75/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KDMPT--------LSEM------KKNISMVFVGSHLISDG------------PIRPLVPAIIEVG 228
            ||:||        |.||      |:..|.|.:.:....:.            |:.||.|..|   
plant   178 KDLPTSGFGPLEPLLEMCREVVNKRTASAVIINTASCLESLSLSWLQQELGIPVYPLGPLHI--- 239

  Fly   229 GIQVKEQPDP--LPQD---IEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVI 288
               ....|.|  |.:|   ||...:...:..|::|.|:  |::|...|::.:.:.:|:. .|..:
plant   240 ---TASSPGPSLLQEDMSCIEWLNKQKPRSVIYISLGT--KAHMETKEMLEMAWGLLNS-NQPFL 298

  Fly   289 W----------KWEDLENTPGNASNI-----FYKDWLPQDDILAHPNTKLFVTHAGKGSITESQY 338
            |          :|  :|..|.....:     :...|.||.::|.||....|.:|.|..|..||..
plant   299 WVIRPGSVAGFEW--IELLPEEVIKMVTERGYIAKWAPQIEVLGHPAVGGFWSHCGWNSTLESIV 361

  Fly   339 HGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQTITEDTFREAINEVLENDKYTQAVRKF----- 398
            .||||:..|:.|:..|| |:.:.|.:.:.:.|:...|   ||.:.         :||::.     
plant   362 EGVPMICRPLQGEQKLN-AMYIESVWKIGIQLEGEVE---REGVE---------RAVKRLIIDEE 413

  Fly   399 SALYRDRPLTPRQSV 413
            .|..|:|.|..::.:
plant   414 GAAMRERALDLKEKL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 65/275 (24%)
egt 6..433 CDD:223071 65/275 (24%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 65/275 (24%)
YjiC 7..431 CDD:224732 65/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.