DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:417 Identity:86/417 - (20%)
Similarity:140/417 - (33%) Gaps:140/417 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KVMHKDIHLIVVPVTKEQERTLENQMASMAGSKNNIITTM------------------------- 62
            |.|.....:::||:..:...|...|:..:..||...||.:                         
plant     3 KKMEAKRRIVLVPIPAQGHVTPLMQLGKVLNSKGFSITVVEGHFNQVSSSSQHFPGFQFVTIKES 67

  Fly    63 -----YLLLNGLDVMV----TSQADLLKDPRFQRVFETKFDLMILGSFFNDFQ--LGVAGKLKVP 116
                 :..|.|::.|:    ||:|. .||...|.:.:...|:..:  .::::.  .|.|.|    
plant    68 LPESEFEKLGGIESMITLNKTSEAS-FKDCISQLLLQQGNDIACI--IYDEYMYFCGAAAK---- 125

  Fly   117 VIVDWMIPSNTMIDEFVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFNYKFNR 181
               ::.|||.....:..||            :.:.|....|..|||..   |:|           
plant   126 ---EFSIPSVIFSTQSAAN------------YVSHPDMQDKVVENLYP---LRY----------- 161

  Fly   182 IYNEIFTDKDMPTLSEM---------------KKNISMVFV-------GSHL--------ISDGP 216
                    ||:|| |.|               |:..|.|.:       .|.|        ||..|
plant   162 --------KDLPT-SGMGPLDRFFELCREVANKRTASAVIINTVSCLESSSLSWLEQKVGISVYP 217

  Fly   217 IRPLVPAIIEVGGIQVKEQPDPLPQD----IEQFMENSSQGAIFLSFGSNIKSYMVKPEIVGIMF 277
            :.||         ......|..|.::    ||...:...:..|::|.|:  ...|...|::.:.:
plant   218 LGPL---------HMTDSSPSSLLEEDRSCIEWLNKQKPKSVIYISIGT--LGQMETKEVLEMSW 271

  Fly   278 KVLSGLKQNVIW--------KWEDLENTPGNASNI-----FYKDWLPQDDILAHPNTKLFVTHAG 329
            . |....|..:|        ....:|:.|.:.:.:     :.....||.::|.||....|.:|.|
plant   272 G-LCNSNQPFLWVIRAGSILGTNGIESLPEDVNKMVSERGYIVKRAPQIEVLGHPAVGGFWSHCG 335

  Fly   330 KGSITESQYHGVPMVALPIFGDHPLNA 356
            ..||.||...||||:..|..|:..|||
plant   336 WNSILESIGEGVPMICKPFHGEQKLNA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 86/417 (21%)
egt 6..433 CDD:223071 86/417 (21%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 86/417 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.