DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT76B1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_187742.1 Gene:UGT76B1 / 820307 AraportID:AT3G11340 Length:447 Species:Arabidopsis thaliana


Alignment Length:225 Identity:54/225 - (24%)
Similarity:84/225 - (37%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ENSSQGAIFLSFGSNIKSYMVKPEIVGI----MFKVLSGLK---QNVIW----------KWED-- 293
            :.::...|:.|.||          |..|    ..::..||:   |..:|          :|.:  
plant   256 KQATNSVIYASLGS----------IASIDESEFLEIAWGLRNSNQPFLWVVRPGLIHGKEWIEIL 310

  Fly   294 ----LENTPGNASNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPL 354
                :||..|....:   .|.||.::|||..|..|:||.|..|..|.....:||:..|.|||..:
plant   311 PKGFIENLEGRGKIV---KWAPQPEVLAHRATGGFLTHCGWNSTLEGICEAIPMICRPSFGDQRV 372

  Fly   355 NAALMVNSGYGVSLDLQTITEDTFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWVDY 419
            ||. .:|..:.:.|.|:...|       ..|:||...|..........|.|.:..:::    |:.
plant   373 NAR-YINDVWKIGLHLENKVE-------RLVIENAVRTLMTSSEGEEIRKRIMPMKET----VEQ 425

  Fly   420 VLRHHGAPNLQSPAVHMGFVELHNLDIYAL 449
            .|:..|:          .|..|.||..|.|
plant   426 CLKLGGS----------SFRNLENLIAYIL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 54/225 (24%)
egt 6..433 CDD:223071 48/207 (23%)
UGT76B1NP_187742.1 Glycosyltransferase_GTB-type 1..444 CDD:415824 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.