DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT74F1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_181912.1 Gene:UGT74F1 / 818988 AraportID:AT2G43840 Length:449 Species:Arabidopsis thaliana


Alignment Length:316 Identity:71/316 - (22%)
Similarity:131/316 - (41%) Gaps:86/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VSYVPNES-----------------TFAT---TPMSFFKRAENLVKHVILKYLTIRFNY-KFNRI 182
            :||:.|.|                 ||.|   :.:::|:        ::|:..|   |: |.:.:
plant   144 LSYINNGSLTLPIKDLPLLELQDLPTFVTPTGSHLAYFE--------MVLQQFT---NFDKADFV 197

  Fly   183 YNEIFTDKDMPTLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQF- 246
            ....|.|.|:.....:.|...::.:|          |.||::..  ..|:|...|   .|:..| 
plant   198 LVNSFHDLDLHEEELLSKVCPVLTIG----------PTVPSMYL--DQQIKSDND---YDLNLFD 247

  Fly   247 ----------MENSSQGA-IFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIWKW-----EDLE 295
                      ::...:|: ::::|||..|....:.|      ::.|.: .|..:.|     |:.:
plant   248 LKEAALCTDWLDKRPEGSVVYIAFGSMAKLSSEQME------EIASAI-SNFSYLWVVRASEESK 305

  Fly   296 NTPGNASNIFYKD------WLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPL 354
            ..||....: .||      |.||..:|::.....|:||.|..|..|....||||||:|.:.|.|:
plant   306 LPPGFLETV-DKDKSLVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPM 369

  Fly   355 NAALMVNSGYGVSLDLQTITEDTF--RE----AINEVLENDKYTQAVRKFSALYRD 404
            ||. .:...:.|.:.::...|...  ||    :|.||:|.:| ::.:::.:..:||
plant   370 NAK-YIQDVWKVGVRVKAEKESGICKREEIEFSIKEVMEGEK-SKEMKENAGKWRD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 71/316 (22%)
egt 6..433 CDD:223071 71/316 (22%)
UGT74F1NP_181912.1 PLN02173 1..449 CDD:177830 71/316 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.