DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT2B17

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:508 Identity:143/508 - (28%)
Similarity:253/508 - (49%) Gaps:54/508 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAEAGHNVTVV----SMMQPKVMHKDIHLIVVPVTKEQERTLENQMASM------AGSKNNIITT 61
            |.:.||.|.|:    |::........|.|.|.| |...:..||:....|      :.|||    |
Human    46 LVQRGHEVIVLTSSASILVNASKSSAIKLEVYP-TSLTKNDLEDFFMKMFDRWTYSISKN----T 105

  Fly    62 MYLLLNGLDVMVTSQAD---------LLKDPRFQRVFETKFDLMILGSFFNDFQLGVAGKLKVPV 117
            .:...:.|..:....:|         :|.....:::.|:||| ::|....|.....:|..|.:|.
Human   106 FWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFD-VLLADAVNPCGELLAELLNIPF 169

  Fly   118 IVDWMIPSNTMIDE----FVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFN-- 176
            :..........:::    |:..|   ||||...:..:..|.|.:|.:|:   :.:.|....|.  
Human   170 LYSLRFSVGYTVEKNGGGFLFPP---SYVPVVMSELSDQMIFMERIKNM---IYMLYFDFWFQAY 228

  Fly   177 --YKFNRIYNEIFTDKDMP-TLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDP 238
              .|:::.|:|:.   ..| ||.|......|..:.::...:.| ||.:|.:..|||:..| ...|
Human   229 DLKKWDQFYSEVL---GRPTTLFETMGKAEMWLIRTYWDFEFP-RPFLPNVDFVGGLHCK-PAKP 288

  Fly   239 LPQDIEQFMENSSQ-GAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIWKWEDLE-NTPGNA 301
            ||:::|:|:::|.: |.:..|.||.|.:  :..|...::...|:.:.|.|:|:::..: ||.|:.
Human   289 LPKEMEEFVQSSGENGIVVFSLGSMISN--MSEESANMIASALAQIPQKVLWRFDGKKPNTLGSN 351

  Fly   302 SNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYGV 366
            :.: || ||||:|:|.||.||.|:||.|...|.|:.|||:|||.:|:|.|...|.|.|...|..:
Human   352 TRL-YK-WLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAAL 414

  Fly   367 SLDLQTITEDTFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWVDYVLRHHGAPNLQS 431
            |:|::|::......|:..|:.:..|.:.:.|.|.::.|:|:.|....:||:::|:||.||.:|:.
Human   415 SVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRV 479

  Fly   432 PAVHMGFVELHNLDIYALVLAILIFLVFLTRLTVKFLFSKLLGKAKVPARKKK 484
            .|.::.:::.|:||:.|.:||.:..::|:......|.|.||   ||...:||:
Human   480 AAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKL---AKTGKKKKR 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 139/499 (28%)
egt 6..433 CDD:223071 127/455 (28%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 136/492 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.