DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT2B7

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001065.2 Gene:UGT2B7 / 7364 HGNCID:12554 Length:529 Species:Homo sapiens


Alignment Length:497 Identity:132/497 - (26%)
Similarity:241/497 - (48%) Gaps:44/497 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAEAGHNVTVVSMMQPKVMHKD------IHLIVVPVTK-EQERTLENQMASMAGSKNNIITTMYL 64
            |.:.||.|||::.....:...:      |.:....:|| |.|..:..|:...:....:   |.:|
Human    46 LIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKD---TFWL 107

  Fly    65 LLNGL--------DVMVTSQADLLKDPRF-QRVFETKFDLMILGSFFNDFQLGVAGKLKVPVIVD 120
            ..:.:        |:......|::.:.:| ::|.|::||::...:.|...:| :|....:|.:..
Human   108 YFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSEL-LAELFNIPFVYS 171

  Fly   121 WMIPSNTMIDE----FVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFNY---- 177
            .........::    |:..|   ||||...:..|..|:|.:|.:|:: :|:  |....|..    
Human   172 LSFSPGYTFEKHSGGFIFPP---SYVPVVMSELTDQMTFMERVKNMI-YVL--YFDFWFEIFDMK 230

  Fly   178 KFNRIYNEIFTDKDMP-TLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQ 241
            |:::.|:|:.   ..| ||||......:..:.:......|. ||:|.:..|||:..| ...|||:
Human   231 KWDQFYSEVL---GRPTTLSETMGKADVWLIRNSWNFQFPY-PLLPNVDFVGGLHCK-PAKPLPK 290

  Fly   242 DIEQFMENSSQ-GAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIWKWEDLENTPGNASNIF 305
            ::|.|:::|.: |.:..|.||.:.:  :..|...::...|:.:.|.|:|:::..:......:...
Human   291 EMEDFVQSSGENGVVVFSLGSMVSN--MTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRL 353

  Fly   306 YKDWLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDL 370
            || |:||:|:|.||.|:.|:||.|...|.|:.|||:|||.:|:|.|.|.|.|.|...|..|.:|.
Human   354 YK-WIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDF 417

  Fly   371 QTITEDTFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWVDYVLRHHGAPNLQSPAVH 435
            .|::......|:..|:.:..|.:.|.|.|.:..|:|:.|....:||:::|:||.||.:|:..|..
Human   418 NTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD 482

  Fly   436 MGFVELHNLDIYALVLAILIFLVFLTRLTVKFLFSKLLGKAK 477
            :.:.:.|:||:...:|..:..::|:......|.|.|...|||
Human   483 LTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 130/495 (26%)
egt 6..433 CDD:223071 120/451 (27%)
UGT2B7NP_001065.2 UDPGT 24..525 CDD:278624 132/497 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3869
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.