DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT2B28

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_444267.1 Gene:UGT2B28 / 54490 HGNCID:13479 Length:529 Species:Homo sapiens


Alignment Length:502 Identity:130/502 - (25%)
Similarity:239/502 - (47%) Gaps:50/502 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KALAEAGHNVTVVSMMQPKVMHKD----IHLIVVP--VTK-EQERTLENQMASMAGSKNNIITTM 62
            |.|.:.||.|||::.....:...:    :.|.|.|  :|| |.|..:..|:...:..:.:.....
Human    44 KELVQRGHEVTVLASSASILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLY 108

  Fly    63 Y-----LLLNGLDVMVTSQADLLKDPR-FQRVFETKFDLMILGSFFNDFQLGVAGKLKVPVIVDW 121
            :     :|....|:......|::.:.: .:::.|::||::...:||...:| :|..|.:|.:...
Human   109 FSQEQEILWEFHDIFRNFCKDVVSNKKVMKKLQESRFDIIFADAFFPCGEL-LAALLNIPFVYSL 172

  Fly   122 MIPSNTMIDE----FVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFNY----K 178
            .......|:.    .:..|   ||:|...:..:..|:|.:|.:|:: :|:  |....|..    |
Human   173 CFTPGYTIERHSGGLIFPP---SYIPVVMSKLSDQMTFMERVKNMI-YVL--YFDFWFQMCDMKK 231

  Fly   179 FNRIYNEI-------FTDKDMPTLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQP 236
            :::.|:|:       |.......:..|:.:.|..|.          .|.:|.|..|||:..| ..
Human   232 WDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFP----------HPFLPNIDFVGGLHCK-PA 285

  Fly   237 DPLPQDIEQFMENSSQ-GAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIWKWEDLENTPGN 300
            .|||:::|:|:::|.: |.:..|.||.|.:  :..|...::...|:.:.|.|:|:::..:.....
Human   286 KPLPKEMEEFVQSSGENGVVVFSLGSVISN--MTAERANVIATALAKIPQKVLWRFDGNKPDALG 348

  Fly   301 ASNIFYKDWLPQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYG 365
            .:...|| |:||:|:|..|.|:.|:||.|...|.|:.|||:|||.:|:|.|.|.|.|.|...|..
Human   349 LNTRLYK-WIPQNDLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAA 412

  Fly   366 VSLDLQTITEDTFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWVDYVLRHHGAPNLQ 430
            |.||..|::......|:..|:.:..|.:.|.|.|.:..|:|:.|....:||:::|:.|.||.:|:
Human   413 VRLDFHTMSSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLR 477

  Fly   431 SPAVHMGFVELHNLDIYALVLAILIFLVFLTRLTVKFLFSKLLGKAK 477
            ..|..:.:.:.|:||:...:||.:..::|:......|.|.|...|.|
Human   478 VAARDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 129/500 (26%)
egt 6..433 CDD:223071 117/455 (26%)
UGT2B28NP_444267.1 UDPGT 24..525 CDD:278624 130/502 (26%)
egt <269..506 CDD:223071 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.