DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:206 Identity:37/206 - (17%)
Similarity:67/206 - (32%) Gaps:97/206 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AKALAEAGHNVTVVSMMQPKVMHKDIHLIVVPVTKEQERTLENQMASMAGSKNNIITTMYLLLNG 68
            |..:|:.||:||   :.||      .|:           .|:| :..:..:||         :..
 Worm    40 ADIIADHGHHVT---LFQP------YHI-----------ALKN-LDGLVKNKN---------IEI 74

  Fly    69 LDVMVTSQADLLK-DPRFQRVFETKFDLMILGSFFNDFQLGVAGKLKVPVIVDWMIPSNTMIDEF 132
            |:...|...:||| :|   :.|...:|..::|:               |||..:::|        
 Worm    75 LNYHPTHYEELLKAEP---QAFSFFWDSHLVGN---------------PVIGAFLMP-------- 113

  Fly   133 VANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFNYKFNRIYNEIFTDKDMPTLSE 197
                   ..:..|  |..|.|                               |:.:|::|..|..
 Worm   114 -------KLIGGE--FKITAM-------------------------------EVLSDRNMLKLQF 138

  Fly   198 MKKNISMVFVG 208
            :.|:..::.||
 Worm   139 VLKHARLIKVG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 37/206 (18%)
egt 6..433 CDD:223071 36/204 (18%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.