DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:437 Identity:133/437 - (30%)
Similarity:204/437 - (46%) Gaps:53/437 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLNGLDVMVTSQADLLKDPRFQRVFETKFD----LMI--LGS---FFNDFQLGVAGKLKVPVIVD 120
            ||:..|:|     :.||:..|..|.....|    |::  ||.   .|..||||..          
  Rat    54 LLSRKDIM-----EFLKNANFDLVLFESVDYCSSLIVEKLGKQFVLFLAFQLGFM---------- 103

  Fly   121 WMIPSNTMIDEFVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFNYKFNRIYNE 185
                      :|......:||||...:..|..|.|:.|.:|.:....|.........:::....|
  Rat   104 ----------DFELQRVPLSYVPVYGSGLTDQMDFWGRVKNFLMFFDLSRKQREILSQYDSTIQE 158

  Fly   186 IFTDKDMPTLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQFM-EN 249
            .|.:...|.||::.....:.||......:. .|||.|.|:.|||: :.:....:|||:|.|: :.
  Rat   159 HFAEGSRPVLSDLLLKAELWFVNCDFAFEF-ARPLFPNIVYVGGL-LDKPVQSIPQDLENFITQF 221

  Fly   250 SSQGAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIWKWEDLENTPGN---ASNIFYKDWLP 311
            ...|.:.::.|:....:..| ||:..|....:.|.|.|||..:| .:.|.:   |.|:...||||
  Rat   222 GDSGFVLVALGTVATKFQTK-EIIKEMNNAFAHLPQGVIWACKD-SHWPKDVTLAPNVKIMDWLP 284

  Fly   312 QDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQTITED 376
            |.|:||||:.:|||||.|..|:.|:..||||||.:..|.|.|.|...:.....|||:.:||:..:
  Rat   285 QTDLLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAE 349

  Fly   377 TFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWVDYVLRHHGAPNLQSPAVHMGFVEL 441
            ||...:.||:|:.:|..|......:....||||.|.:..|:|::|:..||.:|:..|....:.|.
  Rat   350 TFARTMKEVIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYAFQQPWHEQ 414

  Fly   442 HNLDIYALVLAILIFLVFLTRLTVKFLFSKLLG---KAKVPARKKKQ 485
            :.||::       :||:.||..|| :|..|:||   :....|||.||
  Rat   415 YLLDVF-------LFLLGLTLGTV-WLCVKVLGAVMRYLSGARKAKQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 128/427 (30%)
egt 6..433 CDD:223071 114/380 (30%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 117/393 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.