DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37C1 and UGT2A1

DIOPT Version :9

Sequence 1:NP_525007.1 Gene:Ugt37C1 / 53583 FlyBaseID:FBgn0026754 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001376494.1 Gene:UGT2A1 / 10941 HGNCID:12542 Length:737 Species:Homo sapiens


Alignment Length:500 Identity:137/500 - (27%)
Similarity:252/500 - (50%) Gaps:36/500 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAEAGHNVTVVSMMQPKVMHKD----IHLIVVPVTKEQ---ERTLENQMASMAGSKNNIIT--TM 62
            |.:..|||||::......::.:    ::..|:||:.::   :..:|:.:......:...:|  ..
Human   253 LIQRNHNVTVLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAF 317

  Fly    63 Y-----LLLNGLDVMVTSQADLLKDPRFQ-RVFETKFDLMILG--SFFNDFQLGVAGKLKVPVIV 119
            |     ||.....:.:.....:||:|:.. |:.:..||:::..  :...|.   ||.||.:|.:.
Human   318 YKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDL---VALKLGIPFMY 379

  Fly   120 DWMI-PSNTMIDEFVANPSEVSYVPNESTFATTPMSFFKRAENLVKHVILKYLTIRFNYKFNRIY 183
            .... |::|:.......|:.|||||...:..|..|:|.:|.:|.:.:.:..|:...:..::|..|
Human   380 TLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWNSYY 444

  Fly   184 NEIFTDKDMP-TLSEMKKNISMVFVGSHLISDGPIRPLVPAIIEVGGIQVKEQPDPLPQDIEQFM 247
            ::|.   ..| ||.|......:..:.::...:.| ||.:|....|||:..| ...|||:::|:|:
Human   445 SKIL---GRPTTLCETMGKAEIWLIRTYWDFEFP-RPYLPNFEFVGGLHCK-PAKPLPKEMEEFI 504

  Fly   248 ENSSQ-GAIFLSFGSNIKSYMVKPEIVGIMFKVLSGLKQNVIWKWEDLE-NTPGNASNIFYKDWL 310
            ::|.: |.:..|.||.:|:  :..|...::...|:.:.|.|:|:::..: .|.||.:.:|  ||:
Human   505 QSSGKNGVVVFSLGSMVKN--LTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLF--DWI 565

  Fly   311 PQDDILAHPNTKLFVTHAGKGSITESQYHGVPMVALPIFGDHPLNAALMVNSGYGVSLDLQTITE 375
            ||:|:|.||.||.|:||.|...|.|:.|||||||.:|:|.|.|.|.|.|...|..|.::|.|:|.
Human   566 PQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS 630

  Fly   376 DTFREAINEVLENDKYTQAVRKFSALYRDRPLTPRQSVLFWVDYVLRHHGAPNLQSPAVHMGFVE 440
            .....|:..|:....|.:...:.|.::.|:|:.|....:||:::|:||.||.:|:..|..:.:.:
Human   631 VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQ 695

  Fly   441 LHNLDIYALVLAILIFLVFLTRLTVKFLFSKLLGKAKVPARKKKQ 485
            .|:||:...:|..:...:||......|...|.   .|:..:||::
Human   696 YHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKF---GKIGKKKKRE 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37C1NP_525007.1 UDPGT 1..477 CDD:278624 134/490 (27%)
egt 6..433 CDD:223071 125/446 (28%)
UGT2A1NP_001376494.1 UDPGT 237..725 CDD:278624 133/483 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.