DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gclc and GCLC

DIOPT Version :10

Sequence 1:NP_525005.2 Gene:Gclc / 53581 FlyBaseID:FBgn0040319 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001489.1 Gene:GCLC / 2729 HGNCID:4311 Length:637 Species:Homo sapiens


Alignment Length:222 Identity:49/222 - (22%)
Similarity:76/222 - (34%) Gaps:58/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DSENEEDFSGFLSEIEENENEDEF----ENDDEFEDDDELENVDELEDDELSSEEVDIPSENE-- 71
            |.....||...|.::|..|....|    |:....::|.:|| :..:.|| |.::|..:.|..|  
Human    91 DPHGRPDFGSILKQLEVIEQSALFQMPLESFHSLQEDWKLE-IQHMFDD-LRTKEKLVMSRLEGC 153

  Fly    72 ---------------------------VIVELHDGQAEVEESLLDALLGKALAGDQMNSRIEGLF 109
                                       .:...|......||.||.|...:....:|:..|.:.|.
Human   154 ELRADAHKTHLSWDPGPAPAAKPYLWACLPPSHQELRSREEELLRAAQEQRFQEEQLRRREQELA 218

  Fly   110 EDLDSSVEPDIIDRSELEDVDSGISVGAVSSSSAETQASDAKCKNKDAFDMSSLKK------YMQ 168
            |.     |.||::| ||..:.|.:|           |......|.|..|..|.|.|      ::.
Human   219 ER-----EMDIVER-ELHLLMSQLS-----------QEKPRVRKRKGNFKRSRLLKLREGSSHIS 266

  Fly   169 YITEEEHAVSVEDIPDFASKKNVYGTS 195
            ..:..||.::|:..|....:|...|.|
Human   267 LPSGFEHKITVQASPTLDKRKGSDGAS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GclcNP_525005.2 GCS 232..675 CDD:460796
GCLCNP_001489.1 PRK00087 <22..76 CDD:234623
GCS 236..608 CDD:460796 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.