DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and zgc:152938

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:332 Identity:63/332 - (18%)
Similarity:113/332 - (34%) Gaps:118/332 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFLQTK 80
            :.:.|:...:..|      ||.||.....::|.:|..|:....|..:|..||.::|.....::||
Zfish    47 RRKTYWRRMDVEG------LISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTK 105

  Fly    81 WKNIRYNYLQEVKAIE-TGQANPNVRKR-RFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDND 143
            |||:|..|:::.:..: ||:..|..:|. :|.:.:.||..:::...|..|....|.:.|.||   
Zfish   106 WKNLRDTYIRKKREDQCTGEQTPKKKKTWKFMKMMEFLATSSEQRRVHSSVKESADEVGDGS--- 167

  Fly   144 SNSFLYPDPEHLKIDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLPTTLNGTSS 208
                                                            ||::.||:      :..
Zfish   168 ------------------------------------------------ESEKSLSI------SVE 178

  Fly   209 SNHSHEHDQASSPASSPLLTPMVVMGNGYGQEVH-LEQQQTQEQKPFKNSSLSNGEVTIEPIYKP 272
            |..|.|..||:|......:||..|......:||. .|:::.::|:                    
Zfish   179 SAVSSEPVQANSKKRKRSVTPDFVEKYLAAKEVRDREREECRKQR-------------------- 223

  Fly   273 AAIRRALPSDFLTNPFKRKATQAPLQTQVTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFAN 337
                                            ..|.|.|:.:||...:|.:..|::..||..|..
Zfish   224 --------------------------------MEDDISLFLMSLAPVIRRLPPSKQSSVKMRFHQ 256

  Fly   338 ILKDAKY 344
            :|.:.:|
Zfish   257 VLHEVEY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 26/85 (31%)
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 21/67 (31%)
BESS 226..260 CDD:281011 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.