DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:332 Identity:65/332 - (19%)
Similarity:109/332 - (32%) Gaps:113/332 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YYAERETTGPEFD-DRLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFLQTKWKN 83
            :|:.|.:...:.| :.|:.||..|..::|.:|..|:....:..:|..||:::|.....::.||||
Zfish    19 HYSVRRSMVVKMDAELLLFLVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDVEEVKAKWKN 83

  Fly    84 IRYNYLQEVKAIETGQANPNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFL 148
            :|..|               .||:|..:|.|   .:.:....||...|:...:          ||
Zfish    84 LRDTY---------------TRKKRLEQDGS---RSGRAAKKKKQWKYMRVMD----------FL 120

  Fly   149 YPDPEHLK--IDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLPTTLNGTSSSNH 211
            .|..||..  :|:.     ||.|..|:                                      
Zfish   121 DPATEHRSGILDSK-----IEDDEPDE-------------------------------------- 142

  Fly   212 SHEHDQASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIR 276
                |..:.|||:                                   |.|.....|....::|.
Zfish   143 ----DSGAEPAST-----------------------------------STGTSVTSPEAMRSSIV 168

  Fly   277 RALPSDFLTNPFKRKATQAPLQTQVTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKD 341
            :...|:.|....|..||:.....:......|.::|:..||...||.:..|::..||.:...||.|
Zfish   169 KRRRSETLELLEKYLATKDAKDREKDEQQQDEVDLFLRSLAPALRRLPASKQSLVKLQIQKILHD 233

  Fly   342 AKYKDES 348
            |::...|
Zfish   234 AEFGQPS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 22/83 (27%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 27/114 (24%)
BESS 199..233 CDD:308542 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.