DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and hng2

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:233 Identity:53/233 - (22%)
Similarity:89/233 - (38%) Gaps:60/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRF--------------LQTKWKNIRY 86
            |..|.....|::.|||::....:|.:.|.:|.:||  .|.|              |..:|||.|.
  Fly    22 IDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHEL--CSNFDDSSEPEKQEIVKTLLKRWKNTRD 84

  Fly    87 NYLQEVKAIETGQANPNVRKRR--FTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFL- 148
            :||:..:..::|:   .|.:..  :.::||||      .|||..           |::|..|.. 
  Fly    85 SYLRVNRLRQSGE---EVARASYIYEKELSFL------LNVKAE-----------SEDDVESLKE 129

  Fly   149 YPDPE----HLKIDASEGYDIIELDNSDDGSNSDD---NEIVP-ELQLVMGE---SKQQLSLPTT 202
            .|.|:    .:...|..........|||..||.:.   |..:| .:..|:|:   :|:..:.|..
  Fly   130 QPKPQAKRKRVSTAAQRSAKTPRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEI 194

  Fly   203 LN----------GTSSSNHSHEHDQASSPASSPLLTPM 230
            ..          .|:::..|.:.|||......|.:..|
  Fly   195 AYIPQLPSDPPCSTNTAYLSADPDQAFFDTIKPHMQQM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 26/97 (27%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 24/95 (25%)
BESS 216..250 CDD:281011 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.