DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and CG9948

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster


Alignment Length:288 Identity:57/288 - (19%)
Similarity:99/288 - (34%) Gaps:92/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FDDRLIKLVRANPAIYDVSH-PHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKA 94
            ||.:||.||..||.:|..|. .:|.....:.|||.|||..:|....|...:|.|:.|.:.:|.:.
  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75

  Fly    95 IET-GQANPNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHLKID 158
            .:| |...|.:.:.||..::       |..:..|::....:|...........||:         
  Fly    76 ADTSGSTWPYLERLRFLAEI-------QPPSKVKTKPKTNKQEATIQTETPVQFLW--------- 124

  Fly   159 ASEGYDIIELDNSDDGSNSDDNEIVPE------LQLVMGESKQQLSLPTTLNGTSSSNHSHEHDQ 217
                      |..:||.       ||:      ::.|:.|..:|:                    
  Fly   125 ----------DTFEDGD-------VPQQSSTFIIEEVIEEPSEQI-------------------- 152

  Fly   218 ASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIRRALPSD 282
                               ..:|:..|:|:..|....::|.|...::..:  .|....|||    
  Fly   153 -------------------IQEEIIYEEQEPAEIISPRSSFLQMDQILAQ--LKEPQRRRA---- 192

  Fly   283 FLTNPFKRKATQAPLQTQVTSSFNDPIE 310
                  :|:.|...|:.|:.:..|..:|
  Fly   193 ------ERRITAFLLKCQLRALSNQSVE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 26/85 (31%)
CG9948NP_001261492.1 MADF 14..95 CDD:214738 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.