DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and CG10949

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:370 Identity:79/370 - (21%)
Similarity:140/370 - (37%) Gaps:114/370 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSHPHYRRNPVRV--------DIWDRIANELG 71
            |:.::...|.::.....:::||:||:::|.:||       |:.:||        :.|..|:..|.
  Fly   121 ERRRKDEEEEDSQDDLLNEQLIELVKSHPVLYD-------RHKIRVSKNLAAKNEAWREISENLN 178

  Fly    72 ASSRFLQTKWKNIRYNYLQEVKAIETGQANPNVRKRRFTEDLSFLQNTAQ------TYNVKK--- 127
            .|......:||.:|..:.:|.::.:..|:.|..  .|:..||.||....:      ..|:|:   
  Fly   179 VSEELCYNRWKKLRDRFGREFRSHQINQSTPIT--WRYFNDLLFLGRHFRKGVPLVLENIKRRGR 241

  Fly   128 -------SQSYVAQQNGM---------GSDNDSNSFLYP---DPEHLKIDASEGYDIIELDNSDD 173
                   |.....|..||         |:|       ||   |.:.|:.|....||         
  Fly   242 PPKAGNPSGKTSKQPEGMVISSGEQIWGAD-------YPYSTDNDDLEDDLELAYD--------- 290

  Fly   174 GSNSDDNEIVPELQ------LVMGES--------KQQLSLPTTLNGTS--------------SSN 210
                ::.||:.|.:      .::.|:        .|||.:.||...||              ..:
  Fly   291 ----EEIEILSEAEQATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEES 351

  Fly   211 HSHEHDQASSPA-SSPLLTPMVV-------MGNGYGQEVHLEQQQTQEQKPFK--NSSLSNGEVT 265
            .|...|...|.| |..|||.::.       .......::|.||:|.:||:..:  ||.|:..::.
  Fly   352 SSLPGDSVPSAAISDKLLTTVIANMETVLQQSRELQAQIHHEQEQEREQRSTQPANSLLAKAQML 416

  Fly   266 IEPIYKPAAIRRALPSDFLTNPFKRKATQAPLQTQVTSSFNDPIE 310
            ::.:         .||:..:  .:||..|...|.|:.:...:.||
  Fly   417 LDGL---------SPSERAS--AERKIVQFLCQCQIKALDGEEIE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 25/91 (27%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.