DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and madf-9

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:335 Identity:80/335 - (23%)
Similarity:124/335 - (37%) Gaps:72/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PEFDDRLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVK 93
            |.|:.|||..|:|.|.:||.|...|.....|...|:.||..|..:|..::|:||.:|..|.:|.|
 Worm    47 PVFNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDRYKKEEK 111

  Fly    94 AIETGQANPNVRKRR----FTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPE- 153
                   ...|.|:.    |...|.|:|...:..:..::.|           |.|...:.|:|. 
 Worm   112 -------KERVSKKASSWVFQRPLKFIQAHLKDRHTDETDS-----------NQSEPAVKPEPNG 158

  Fly   154 HLK-IDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLPTTLNGTSSSN-HSHEHD 216
            |:. ::|:..:...||..:.|.|.|..:         .||.:.. |..|..:.:||.| .:.|..
 Worm   159 HVSPMEAAMSFIENELIRTQDSSKSSGS---------TGEMESS-SASTASSASSSKNTGTQEGG 213

  Fly   217 QASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIR-RALP 280
            :||.....||..||.|                 ...|...||.|||        .||..| |...
 Worm   214 EASVITPPPLPIPMAV-----------------TPSPSATSSASNG--------GPAVKRSRVSI 253

  Fly   281 SDFLTNPFKRKATQAP-----------LQTQVTSSFNDPIELYCLSLVDTLRSMRRSERERVKFE 334
            ::.:|....|.|..|.           |....|:...:..|::...:...|..:....:|..|.:
 Worm   254 TEGMTPVASRNAAAAAAASLGLSFFPGLSQWATTREEEEDEIFARMISIKLSKLDARTKEVAKLQ 318

  Fly   335 FANILKDAKY 344
            ....:.||::
 Worm   319 VLKAIFDAQF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 28/87 (32%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.