DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:328 Identity:69/328 - (21%)
Similarity:113/328 - (34%) Gaps:101/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DRLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKAIET 97
            ::||:.|.|.|.:|:||...||....||..|..:|..:|.|....:.:||.||..|::|.:..  
Zfish     7 EKLIQTVYAFPVLYNVSLHDYRSTERRVKAWREVAASVGLSVVECKRRWKTIRDRYIRERRLC-- 69

  Fly    98 GQANPNVRKRRF-----TEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHLKI 157
             :...::..||.     .|.|:||.     .:::|.:.....|.             |:.|    
Zfish    70 -KLKKDLGGRRLHYWPHRESLAFLD-----AHIRKRRRPSGAQG-------------PEEE---- 111

  Fly   158 DASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLPTTLNGTSSSNHSHEHDQASSPA 222
                     :.:.....:..:|.|.|.| :.|                          |..|..|
Zfish   112 ---------QQEEHSSAALQEDKECVSE-ECV--------------------------DSGSRLA 140

  Fly   223 SSPLLTPMVVMGNGYGQEVHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIRRALPSDFLTNP 287
            .|||  |:.:|                       |:....::...|...|..: .|||......|
Zfish   141 VSPL--PVSIM-----------------------SAPPPPQLKAVPQVSPLLL-AALPPGLKVAP 179

  Fly   288 FKRKAT--------QAPLQTQV-TSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKDAK 343
            ....||        ..||:.|. .....|..:|:.||.|..|:.:...:|..||.:...|:.:|:
Zfish   180 VCSSATGSASAGPLNVPLEEQQRADGALDEDQLFLLSYVPALKRLTPQKRAAVKMQIQQIMFNAE 244

  Fly   344 YKD 346
            :|:
Zfish   245 FKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 28/88 (32%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 28/96 (29%)
BESS 208..242 CDD:281011 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.