DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlip3 and LOC100330838

DIOPT Version :9

Sequence 1:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:317 Identity:49/317 - (15%)
Similarity:104/317 - (32%) Gaps:121/317 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDRLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKAIE 96
            ::|||..|...|.:|:.:...|:....:...|..::.::.......:.:||::|..::::.:|.:
Zfish     6 EERLIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQ 70

  Fly    97 TGQAN-PNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHLKIDAS 160
            ..:|: .:.|..:::..:|||....|                      |.|....:||..:.|  
Zfish    71 RRRASGTSHRSWKYSWQMSFLTPFIQ----------------------SRSLAADEPEEDRDD-- 111

  Fly   161 EGYDIIELDNSDDGSNSDDNE--IVPELQLVMGESKQQLSLPTTLNGTSSSNHSHEHDQASSPAS 223
                    ::.|:...:|.|.  :|.:.:...|          .|:|.|       |..||..  
Zfish   112 --------EDKDEERTADGNSAFVVQDFEGDHG----------MLDGAS-------HYSASGS-- 149

  Fly   224 SPLLTPMVVMGNGYGQEVHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIRRALPSDFLTNPF 288
                     .|:|..::.|:|..:..|.                                     
Zfish   150 ---------QGSGRKRKWHMEANEDLED------------------------------------- 168

  Fly   289 KRKATQAPLQTQVTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKDAKYK 345
                                 |::..||:..||.:..:::..||.:...:|.:|::|
Zfish   169 ---------------------EMFLFSLLPYLRRLPYAKKSAVKLKIHQLLYEAEFK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 17/84 (20%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 17/87 (20%)
BESS 167..200 CDD:397204 9/90 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.