DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and PRX1

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_009489.1 Gene:PRX1 / 852215 SGDID:S000000160 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:66/200 - (33%)
Similarity:97/200 - (48%) Gaps:20/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLQKPAPAFAGTAVVNGVFKDIKLSDYKG-KYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINC 66
            ::...||.|.....|.    .|...||.| .:.|||.:|.|||.||.||:.||::...||.|.|.
Yeast    50 RINSDAPNFDADTTVG----KINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNV 110

  Fly    67 EVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGI---------PF 122
            ::||.|.:...:|..||...::...:.::..|::.|....||..|.::|.| |.         ..
Yeast   111 KLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAE-GFKNINDGSLKTV 174

  Fly   123 RGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVA-----D 182
            |.:|:||.|:.:|.|......|||:..|.||::.|.|.|||.|.|.|.||:|....::.     |
Yeast   175 RSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSND 239

  Fly   183 PTKSK 187
            ..|:|
Yeast   240 EAKAK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 62/180 (34%)
PRX1NP_009489.1 PRX_1cys 51..259 CDD:239314 65/198 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.