DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and PER1

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_175247.1 Gene:PER1 / 841231 AraportID:AT1G48130 Length:216 Species:Arabidopsis thaliana


Alignment Length:167 Identity:47/167 - (28%)
Similarity:79/167 - (47%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLSDY-KGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRK 88
            ||.|| ...:.|||.:|.|||.||.||:.|.::.|.||.|...:::|.|.|...:|..||.....
plant    23 KLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHKDWIKDIEA 87

  Fly    89 QGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLR 153
            ......::.|::||.:.::.....::|.....|.|.|.|:.....::...:.....||:::|.||
plant    88 FNHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTTGRNMDEVLR 152

  Fly   154 LVQAFQYTDKYGE--VCPANWKPGQKTMVADPTKSKE 188
            .:.:.....|:..  ..|.||||.|..:::.....:|
plant   153 ALDSLLMASKHNNKIATPVNWKPDQPVVISPAVSDEE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 44/152 (29%)
PER1NP_175247.1 PRX_1cys 6..214 CDD:239314 47/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.