DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and PRXQ

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001189979.1 Gene:PRXQ / 822203 AraportID:AT3G26060 Length:217 Species:Arabidopsis thaliana


Alignment Length:141 Identity:47/141 - (33%)
Similarity:76/141 - (53%) Gaps:10/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAW 82
            ||  |.:.|..||||.:||:|||.|.|..|..:..||.:|..:|:|...||||.|.|...:|.|:
plant    85 NG--KPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAF 147

  Fly    83 INTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETG-IPFRGLFIIDDKQNLRQITVNDLPVGR 146
            .:..:       :...||:|:..||.:|:||..:..| :|.|..:::|....::.|..|.....:
plant   148 ASKYK-------LPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEK 205

  Fly   147 SVEETLRLVQA 157
            .::|||:.::|
plant   206 HIDETLKFLKA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 47/141 (33%)
PRXQNP_001189979.1 PRX_BCP 74..212 CDD:239315 45/135 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.