DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and prdx2

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001002468.1 Gene:prdx2 / 791455 ZFINID:ZDB-GENE-030326-2 Length:197 Species:Danio rerio


Alignment Length:188 Identity:141/188 - (75%)
Similarity:163/188 - (86%) Gaps:0/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCE 67
            ::.:|||.|..||||:|.||||:||||:|||:||||||||||||||||||||||.|||||||..|
Zfish     7 KIGQPAPQFKATAVVDGQFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSERAAEFRKIGVE 71

  Fly    68 VIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQ 132
            :|..||||.|:|||||||||||||||||:|||:||.:..::||||||.|:.||.:||||:||||.
Zfish    72 LIAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDKG 136

  Fly   133 NLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190
            .|||||:|||||||||:||||||||||:||||||||||.||||..|:|.|..||||:|
Zfish   137 ILRQITINDLPVGRSVDETLRLVQAFQHTDKYGEVCPAGWKPGSDTIVPDVQKSKEFF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 131/170 (77%)
prdx2NP_001002468.1 PTZ00253 1..195 CDD:140280 141/188 (75%)
PRX_Typ2cys 8..179 CDD:239313 131/170 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2859
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H21182
Inparanoid 1 1.050 297 1.000 Inparanoid score I2711
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm26414
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1558
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.