DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and prdx4

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001082894.1 Gene:prdx4 / 570477 ZFINID:ZDB-GENE-030131-1096 Length:260 Species:Danio rerio


Alignment Length:189 Identity:133/189 - (70%)
Similarity:156/189 - (82%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCE 67
            ::.||||.:.||||:||.||::|||||||||||.|||||||||||||||||||:...||:.||.|
Zfish    69 KISKPAPHWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFQAINAE 133

  Fly    68 VIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQ 132
            |:.||.||||||||||||||||||||.|.||||:|.:.::::||||..|:.|...|||||||.|.
Zfish   134 VVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVFLEDQGHTLRGLFIIDGKG 198

  Fly   133 NLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191
            .|||||:|||||||||:||||||||||||||:||||||.||||..|::.||....:||:
Zfish   199 VLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTIIPDPAGKLKYFD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 126/170 (74%)
prdx4NP_001082894.1 PTZ00253 68..256 CDD:140280 131/186 (70%)
PRX_Typ2cys 70..241 CDD:239313 126/170 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.