DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and prdx1

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001011135.1 Gene:prdx1 / 496551 XenbaseID:XB-GENE-481165 Length:199 Species:Xenopus tropicalis


Alignment Length:185 Identity:129/185 - (69%)
Similarity:153/185 - (82%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAPAFAGTAVV-NGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIG 70
            |||.|...||: :|.|||:|:|||||||:|.|||||||||||||||||||:...||:|:||||||
 Frog    11 PAPDFTAKAVMPDGQFKDLKVSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRVEEFKKLNCEVIG 75

  Fly    71 CSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLR 135
            .|.||.|.|||||:.|||:||||.|:|||::|....:|:||||.:|:.|:.||||||||:|..||
 Frog    76 ASGDSHFCHLAWISQPRKEGGLGKMNIPLVSDVQHTIAKDYGVFEEKEGVSFRGLFIIDEKGILR 140

  Fly   136 QITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190
            |||:|||||||||:||||||||||:||||||||||.|:||..|:..|..||||||
 Frog   141 QITINDLPVGRSVDETLRLVQAFQFTDKYGEVCPAGWQPGSDTIKPDVKKSKEYF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 119/168 (71%)
prdx1NP_001011135.1 PRX_Typ2cys 8..180 CDD:239313 119/168 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.