DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and CG6888

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster


Alignment Length:191 Identity:118/191 - (61%)
Similarity:152/191 - (79%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKIN 65
            |..:.:.||.|...|||:|.:::..|:|.:|:|::|.|||.||::|||||:.|||:.|.|||.:.
  Fly     3 MLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVG 67

  Fly    66 CEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDD 130
            |||:.|||||.|.|.||:|||||.||||.:||||||||:||:|||||||||:||:..|.|||||.
  Fly    68 CEVLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDR 132

  Fly   131 KQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191
            :..:|||||||:.|||||:|.||||||||::|::|||||.||:||.|||.||.|..:|||:
  Fly   133 EGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 106/170 (62%)
CG6888NP_648759.1 AhpC 3..194 CDD:223527 118/191 (62%)
PRX_Typ2cys 6..177 CDD:239313 106/170 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473000
Domainoid 1 1.000 46 1.000 Domainoid score I4585
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I247
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm51377
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - P PTHR10681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
1110.800

Return to query results.
Submit another query.