DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and prdx2

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_989001.1 Gene:prdx2 / 394597 XenbaseID:XB-GENE-945852 Length:206 Species:Xenopus tropicalis


Alignment Length:185 Identity:133/185 - (71%)
Similarity:156/185 - (84%) Gaps:0/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIG 70
            :|||||..||||||.||||:||||.|||:|||||||||||||||||||||:.|.:|.||||::|.
 Frog    18 QPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQLIA 82

  Fly    71 CSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLR 135
            .|.|||||||||.|.|||:||||.::|||::|.:..:|:|||||.||.|:.:|||||||.|.|||
 Frog    83 VSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLR 147

  Fly   136 QITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190
            |||:|||||||||||||||||||||||::||||||.||||..|:..:...|||:|
 Frog   148 QITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 126/168 (75%)
prdx2NP_989001.1 PRX_Typ2cys 16..187 CDD:239313 126/168 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I2999
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H21182
Inparanoid 1 1.050 284 1.000 Inparanoid score I2801
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - oto104517
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1558
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.