DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and CG12896

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster


Alignment Length:173 Identity:59/173 - (34%)
Similarity:86/173 - (49%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKLSDYKG-KYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWIN--- 84
            ||..:::| .::|||.:|.|||.||.||:...:....||.|.|.:.:..|.|:..:|:.|:|   
  Fly    19 IKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAHSVDALNSHVDWVNDIK 83

  Fly    85 -----TPRKQGGLGSMDIPLLADKSMKVARDYGVLDE------ETGIPFRGLFIIDDKQNLRQIT 138
                 .|      |....|::||.:..:|...|:|||      |.|...|.||||.....:|...
  Fly    84 SYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFIISPDHKVRLSM 142

  Fly   139 VNDLPVGRSVEETLRLVQAFQYTDKYGEVC-PANWKPGQKTMV 180
            ...:..||:|:|.||.:.:.|.||:...|. ||||.||.|.|:
  Fly   143 FYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 55/166 (33%)
CG12896NP_610584.2 AhpC 1..194 CDD:223527 59/173 (34%)
PRX_1cys 3..218 CDD:239314 59/173 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.