DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and Prx6005

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster


Alignment Length:162 Identity:55/162 - (33%)
Similarity:87/162 - (53%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDI 97
            :.:||.:|.|||.||.||:...:....||:|...:.|..|.|:..:|..||...:..|.|.|.|.
  Fly    34 WAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPIALSCDTVESHKGWIEDIKSFGKLSSFDY 98

  Fly    98 PLLADKSMKVARDYGVLDEE----TGIPF--RGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQ 156
            |::||...::|..:.:||::    .|||.  |.:|::|||:.||...:.....||:.:|.||::.
  Fly    99 PIIADDKRELALKFNMLDKDEINAEGIPLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILRVID 163

  Fly   157 AFQYTDKYGEVCPANWKPGQKTMVADPTKSKE 188
            :.|.|.......||:||.|.|.||....|:::
  Fly   164 SLQLTQTKSVATPADWKQGGKCMVLPTVKAED 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 50/147 (34%)
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 55/162 (34%)
AhpC 8..198 CDD:223527 55/162 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.