DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and Prdx1

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_035164.1 Gene:Prdx1 / 18477 MGIID:99523 Length:199 Species:Mus musculus


Alignment Length:185 Identity:132/185 - (71%)
Similarity:153/185 - (82%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAPAFAGTAVV-NGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIG 70
            |||.|..|||: :|.||||.||:|||||:|.|||||||||||||||||||:.|.||:|:||:|||
Mouse    11 PAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIG 75

  Fly    71 CSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLR 135
            .|.||.|.||||||||:||||||.|:|||::|....:|:|||||..:.||.||||||||||..||
Mouse    76 ASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR 140

  Fly   136 QITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190
            |||:|||||||||:|.:|||||||:|||:||||||.||||..|:..|..||||||
Mouse   141 QITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 122/168 (73%)
Prdx1NP_035164.1 PRX_Typ2cys 8..180 CDD:239313 122/168 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 195 1.000 Domainoid score I3141
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm43789
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - LDO PTHR10681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1558
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.