DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jafrac1 and prdx-6

DIOPT Version :9

Sequence 1:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_741287.1 Gene:prdx-6 / 176837 WormBaseID:WBGene00021401 Length:231 Species:Caenorhabditis elegans


Alignment Length:192 Identity:58/192 - (30%)
Similarity:91/192 - (47%) Gaps:17/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GTAVVNGVF-----KDIKLSDYKG-KYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGC 71
            |..|.|..|     |:..|.:|.| ::|:||.:|.|||.||.||:....:.|.||||.:.:::..
 Worm     4 GDTVPNFTFETDLRKNQTLHNYIGEQWLMLFSHPADFTPVCTTELAELVKLAPEFRKRHVQILAI 68

  Fly    72 STDSQFTHLAW---INTPRKQGGLGS-MDIPLLADKSMKVARDYGVLD------EETGIPFRGLF 126
            |.||..||..|   ||:..:....|| :...::||....:..:.|::|      |...:..|.:.
 Worm    69 SIDSSETHRDWAKDINSVAQLSNCGSHLPFEIIADTDRSICTELGMIDPDEMNSEGICLSARAVM 133

  Fly   127 IIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKE 188
            :....:.|:...:.....||:..|.||:|...|...|.....||||..|. .::|.|:.|:|
 Worm   134 LFGPDKKLKSKILYPATFGRNFVEILRMVDGVQLGTKAPVATPANWIAGD-NVIAQPSLSQE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 53/177 (30%)
prdx-6NP_741287.1 PRX_1cys 3..221 CDD:239314 58/192 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.